CSNK1G3 (NM_001031812) Human Recombinant Protein
CAT#: TP307965
Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207965 protein sequence
Red=Cloning site Green=Tags(s) MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVA IKLEPMKSRAPQLHLEYRFYEQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVL MIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLT GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAH QHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQ RHK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026982 |
Locus ID | 1456 |
UniProt ID | Q9Y6M4 |
Cytogenetics | 5q23.2 |
Refseq Size | 4651 |
Refseq ORF | 1269 |
Synonyms | CKI-gamma 3; CSNK1G3L |
Summary | This gene encodes a member of a family of serine/threonine protein kinases that phosphorylate caseins and other acidic proteins. A related protein in the African clawed frog participates in the transmission of Wnt/beta-catenin signaling. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Hedgehog signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401396 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420831 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420832 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC422199 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401396 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1 |
USD 665.00 |
|
LY420831 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 3 |
USD 436.00 |
|
LY420832 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4 |
USD 665.00 |
|
LY422199 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2 |
USD 436.00 |
|
PH307965 | CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001026982) |
USD 3,255.00 |
|
PH322230 | CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001038188) |
USD 3,255.00 |
|
PH322490 | CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_004375) |
USD 3,255.00 |
|
TP322230 | Purified recombinant protein of Homo sapiens casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4, 20 µg |
USD 867.00 |
|
TP322490 | Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review