SDF1 (CXCL12) (NM_199168) Human Recombinant Protein
CAT#: TP307891
Purified recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 1, with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207891 representing NM_199168
Red=Cloning site Green=Tags(s) MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV CIDPKLKWIQEYLEKALNK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Cell treatment (PMID: 29436696) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954637 |
Locus ID | 6387 |
UniProt ID | P48061 |
Cytogenetics | 10q11.21 |
Refseq Size | 1937 |
Refseq ORF | 267 |
Synonyms | IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1 |
Summary | This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Axon guidance, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Leukocyte transendothelial migration |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424610 | CXCL12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424610 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 436.00 |
|
PH307891 | CXCL12 MS Standard C13 and N15-labeled recombinant protein (NP_954637) |
USD 3,255.00 |
|
TP720102 | Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 330.00 |
|
TP720103 | Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 330.00 |
|
TP723784 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12 / SDF-1alpha), transcript variant 1 |
USD 415.00 |
|
TP723843 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12 / SDF-1beta), transcript variant 2 |
USD 415.00 |
|
TP750013 | Recombinant protein of human stromal cell-derived factor-1 (SDF-1) produced in E. coli. |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review