KCTD10 (NM_031954) Human Recombinant Protein

CAT#: TP307723

Recombinant protein of human potassium channel tetramerisation domain containing 10 (KCTD10), 20 µg

Product Images

Coomassie blue staining of purified KCTD10 protein (Cat# TP307723). The protein was produced from HEK293T cells transfected with KCTD10 cDNA clone (Cat# RC207723) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207723 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTD
  SEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKV
  PVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDE
  ICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAG
  RSHHLDEDEERERIERVRRIHIKRPDDRAHLHQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_114160
• Locus ID: 83892
• UniProt ID: Q9H3F6, A0A024RBJ2
• Cytogenetics: 12q24.11
• Refseq Size: 4057
• Refseq ORF: 939
• Synonyms: BTBD28; hBACURD3; MSTP028; ULRO61
• Summary: The protein encoded by this gene binds proliferating cell nuclear antigen (PCNA) and may be involved in DNA synthesis and cell proliferation. In addition, the encoded protein may be a tumor suppressor. Several protein-coding and non-protein coding transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]
• Protein Families: Ion Channels: Other