FGL2 (NM_006682) Human Recombinant Protein

CAT#: TP307557SE

Purified recombinant protein of Human fibrinogen-like 2 (FGL2), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified FGL2 protein (Cat #TP307557SE). The protein was produced from mammalian cells transfected with FGL2 cDNA clone (Cat #RC207557).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207557 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPK
  QFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKL
  SSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIY
  KDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR
  EFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYN
  HDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG
  YKSSFKEAKMMIRPKHFKP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 51.2 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006673
• Locus ID: 10875
• UniProt ID: Q14314, A4D1B8
• Cytogenetics: 7q11.23
• Refseq Size: 4268
• Refseq ORF: 1317
• Synonyms: pT49; T49
• Summary: The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein