Profilin 2 (PFN2) (NM_053024) Human Recombinant Protein

CAT#: TP307366

Recombinant protein of human profilin 2 (PFN2), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified PFN2 protein (Cat# TP307366). The protein was produced from HEK293T cells transfected with PFN2 cDNA clone (Cat# RC207366) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207366 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK
  CSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444252
• Locus ID: 5217
• UniProt ID: P35080
• Cytogenetics: 3q25.1
• Refseq Size: 2117
• Refseq ORF: 420
• Synonyms: D3S1319E; PFL
• Summary: The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Regulation of actin cytoskeleton