GCLM (NM_002061) Human Recombinant Protein

CAT#: TP307224M

Recombinant protein of human glutamate-cysteine ligase, modifier subunit (GCLM), 100 µg

Product Images

Coomassie blue staining of purified GCLM protein (Cat# TP307224). The protein was produced from HEK293T cells transfected with GCLM cDNA clone (Cat# RC207224) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207224 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVL
  ECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSL
  EHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQ
  LLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 30.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002052
• Locus ID: 2730
• UniProt ID: P48507
• Cytogenetics: 1p22.1
• Refseq Size: 3074
• Refseq ORF: 822
• Synonyms: GLCLR
• Summary: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Glutathione metabolism, Metabolic pathways