PPM1K (NM_152542) Human Recombinant Protein

CAT#: TP307144

Recombinant protein of human protein phosphatase 1K (PP2C domain containing) (PPM1K), 20 µg

Product Images

Coomassie blue staining of purified PPM1K protein (Cat# TP307144). The protein was produced from HEK293T cells transfected with PPM1K cDNA clone (Cat# RC207144) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207144 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPATWDNFGIWDNR
  IDEPILLPPSIKYGKPIPKISLEKVGCASQIGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHT
  HMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIELVVASVGDSR
  AILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPET
  KRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWG
  KYKNSEINFSFSRSFASSGRWA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689755
• Locus ID: 152926
• UniProt ID: Q8N3J5
• Cytogenetics: 4q22.1
• Refseq Size: 6590
• Refseq ORF: 1116
• Synonyms: BDP; MSUDMV; PP2Ckappa; PP2Cm; PTMP; UG0882E07
• Summary: This gene encodes a member of the PPM family of Mn2+/Mg2+-dependent protein phosphatases. The encoded protein, essential for cell survival and development, is targeted to the mitochondria where it plays a key role in regulation of the mitochondrial permeability transition pore. [provided by RefSeq, Sep 2012]
• Protein Families: Phosphatase