CSRP1 (NM_004078) Human Recombinant Protein
CAT#: TP307109
Recombinant protein of human cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207109 protein sequence
Red=Cloning site Green=Tags(s) MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004069 |
Locus ID | 1465 |
UniProt ID | P21291, A0A384P5K2 |
Cytogenetics | 1q32.1 |
Refseq Size | 1970 |
Refseq ORF | 579 |
Synonyms | CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286 |
Summary | This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418221 | CSRP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418221 | Transient overexpression lysate of cysteine and glycine-rich protein 1 (CSRP1), transcript variant 1 |
USD 436.00 |
|
PH307109 | CSRP1 MS Standard C13 and N15-labeled recombinant protein (NP_004069) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review