MYL7 (NM_021223) Human Recombinant Protein

CAT#: TP306449M

Recombinant protein of human myosin, light chain 7, regulatory (MYL7), 100 µg

Product Images

Coomassie blue staining of purified MYL7 protein (Cat# TP306449). The protein was produced from HEK293T cells transfected with MYL7 cDNA clone (Cat# RC206449) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206449 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVP
  EEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSP
  AEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067046
• Locus ID: 58498
• UniProt ID: Q01449
• Cytogenetics: 7p13
• Refseq Size: 619
• Refseq ORF: 525
• Synonyms: MYL2A; MYLC2A
• Protein Families: Druggable Genome
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction