TMEM25 (NM_032780) Human Recombinant Protein

SKU
TP306385
Recombinant protein of human transmembrane protein 25 (TMEM25), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206385 protein sequence
Red=Cloning site Green=Tags(s)

MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQ
LQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQ
EAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVA
TNDVGVTSASLPAPGLLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSD
SNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVL
GYIYRVSSVSSDEIWL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_116169
Locus ID 84866
UniProt ID Q86YD3
Cytogenetics 11q23.3
RefSeq Size 2551
RefSeq ORF 1098
Summary In neurons, modulates the degradation of NMDA receptor GRIN2B subunit. Plays a role in the regulation of neuronal excitability.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM25 (NM_032780) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306385 TMEM25 MS Standard C13 and N15-labeled recombinant protein (NP_116169) 10 ug
$3,255.00
LC409928 TMEM25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428484 TMEM25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409928 Transient overexpression lysate of transmembrane protein 25 (TMEM25), transcript variant 1 100 ug
$436.00
LY428484 Transient overexpression lysate of transmembrane protein 25 (TMEM25), transcript variant 5 100 ug
$436.00
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.