SCRN1 (NM_014766) Human Recombinant Protein
CAT#: TP306268
Recombinant protein of human secernin 1 (SCRN1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206268 protein sequence
Red=Cloning site Green=Tags(s) MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI SRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQG GNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQS QGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVS VLPQNRSSPCIHYFTGTHDPSRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKA HEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055581 |
Locus ID | 9805 |
UniProt ID | Q12765, A0A090N7T9 |
Cytogenetics | 7p14.3 |
Refseq Size | 5278 |
Refseq ORF | 1242 |
Synonyms | SES1 |
Summary | This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414994 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428918 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428919 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428920 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414994 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 2 |
USD 436.00 |
|
LY428918 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 1 |
USD 436.00 |
|
LY428919 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 3 |
USD 436.00 |
|
LY428920 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 4 |
USD 436.00 |
|
PH306268 | SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_055581) |
USD 3,255.00 |
|
PH327072 | SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138985) |
USD 3,255.00 |
|
TP327072 | Recombinant protein of human secernin 1 (SCRN1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review