GNGT1 (NM_021955) Human Recombinant Protein

CAT#: TP305899

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), 20 µg

Product Images

Coomassie blue staining of purified GNGT1 protein (Cat# TP305899). The protein was produced from HEK293T cells transfected with GNGT1 cDNA clone (Cat# RC205899) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205899 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGG
  CVIS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068774
• Locus ID: 2792
• UniProt ID: P63211
• Cytogenetics: 7q21.3
• Refseq Size: 628
• Refseq ORF: 222
• Synonyms: GNG1
• Summary: This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase by rhodopsin. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway