CYB5R1 (NM_016243) Human Recombinant Protein

CAT#: TP305833

Recombinant protein of human cytochrome b5 reductase 1 (CYB5R1), 20 µg

Product Images

Coomassie blue staining of purified CYB5R1 protein (Cat# TP305833). The protein was produced from HEK293T cells transfected with CYB5R1 cDNA clone (Cat# RC205833) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205833 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPT
  AHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKV
  GDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFL
  LFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGP
  PPMVQLACHPNLDKLGYSQKMRFTY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057327
• Locus ID: 51706
• UniProt ID: Q9UHQ9
• Cytogenetics: 1q32.1
• Refseq Size: 1675
• Refseq ORF: 915
• Synonyms: B5R.1; B5R1; B5R2; humb5R2; NQO3A2
• Summary: NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Amino sugar and nucleotide sugar metabolism