Non Neuronal Enolase (ENO1) (NM_001428) Human Recombinant Protein

CAT#: TP305494

Recombinant protein of human enolase 1, (alpha) (ENO1), 20 µg

Product Images

Coomassie blue staining of purified ENO1 protein (Cat# TP305494). The protein was produced from HEK293T cells transfected with ENO1 cDNA clone (Cat# RC205494) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205494 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN
  KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN
  SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE
  GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY
  KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV
  TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
  AKFAGRNFRNPLAK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47 kDa
• Concentration: >0.1 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001419
• Locus ID: 2023
• UniProt ID: P06733, A0A024R4F1
• Cytogenetics: 1p36.23
• Refseq Size: 2204
• Refseq ORF: 1302
• Synonyms: ENO1L1; HEL-S-17; MPB1; NNE; PPH
• Summary: This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. [provided by RefSeq, Jan 2011]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation