MAGEB2 (NM_002364) Human Recombinant Protein

CAT#: TP305338M

Recombinant protein of human melanoma antigen family B, 2 (MAGEB2), 100 µg

Product Images

Coomassie blue staining of purified MAGEB2 protein (Cat# TP305338). The protein was produced from HEK293T cells transfected with MAGEB2 cDNA clone (Cat# RC205338) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205338 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAA
  AAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKI
  VGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGV
  IFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAY
  AETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002355
• Locus ID: 4113
• UniProt ID: O15479, Q53G50
• Cytogenetics: Xp21.2
• Refseq Size: 1628
• Refseq ORF: 957
• Synonyms: CT3.2; DAM6; MAGE-XP-2
• Summary: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region. It is expressed in testis and placenta, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21. [provided by RefSeq, Jul 2008]