Aquaporin 1 (AQP1) (NM_198098) Human Recombinant Protein

CAT#: TP305304

Recombinant protein of human aquaporin 1 (Colton blood group) (AQP1), 20 µg

Product Images

Coomassie blue staining of purified AQP1 protein (Cat# TP305304). The protein was produced from HEK293T cells transfected with AQP1 cDNA clone (Cat# RC205304) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205304 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTTVQDNVKVSLAFGLSIATLAQSVGHI
  SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG
  IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW
  IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_932766
• Locus ID: 358
• UniProt ID: P29972, A0A024RA31
• Cytogenetics: 7p14.3
• Refseq Size: 2807
• Refseq ORF: 807
• Synonyms: AQP-CHIP; CHIP28; CO
• Summary: This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane