GPR85 (NM_018970) Human Recombinant Protein

CAT#: TP305181

Recombinant protein of human G protein-coupled receptor 85 (GPR85), 20 µg

Product Images

Coomassie blue staining of purified GPR85 protein (Cat# TP305181). The protein was produced from HEK293T cells transfected with GPR85 cDNA clone (Cat# RC205181) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205181 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRS
  AICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLA
  VICMVWTLSVAMAFPPVLDVGTYSFIREEDQCAFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVH
  DRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKME
  KRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCF
  STTLLYCRKSRLPREPYCVI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061843
• Locus ID: 54329
• UniProt ID: P60893, A4D0T8, Q8NEN2
• Cytogenetics: 7q31.1
• Refseq Size: 4948
• Refseq ORF: 1110
• Synonyms: SREB; SREB2
• Summary: Members of the G protein-coupled receptor (GPCR) family, such as GPR85, have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli, such as neurotransmitters, hormones, or light, induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins (Matsumoto et al., 2000 [PubMed 10833454]).[supplied by OMIM, Aug 2008]
• Protein Families: Druggable Genome, GPCR, Transmembrane