COQ10B (NM_025147) Human Recombinant Protein
CAT#: TP305174
Recombinant protein of human coenzyme Q10 homolog B (S. cerevisiae) (COQ10B), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205174 protein sequence
Red=Cloning site Green=Tags(s) MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAP LINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVV TLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVA AFERRACKLYGPETNIPRELMLHEVHHT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079423 |
Locus ID | 80219 |
UniProt ID | Q9H8M1 |
Cytogenetics | 2q33.1 |
Refseq Size | 1989 |
Refseq ORF | 714 |
Summary | Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410865 | COQ10B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410865 | Transient overexpression lysate of coenzyme Q10 homolog B (S. cerevisiae) (COQ10B), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
PH305174 | COQ10B MS Standard C13 and N15-labeled recombinant protein (NP_079423) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review