Somatostatin Receptor 2 (SSTR2) (NM_001050) Human Recombinant Protein
CAT#: TP305146
Recombinant protein of human somatostatin receptor 2 (SSTR2), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205146 protein sequence
Red=Cloning site Green=Tags(s) MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILR YAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDR YLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFII YTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSV SMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRL NETTETQRTLLNGDLQTSI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001041 |
Locus ID | 6752 |
UniProt ID | P30874 |
Cytogenetics | 17q25.1 |
Refseq Size | 2996 |
Refseq ORF | 1107 |
Summary | Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400438 | SSTR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400438 | Transient overexpression lysate of somatostatin receptor 2 (SSTR2) |
USD 436.00 |
|
PH305146 | SSTR2 MS Standard C13 and N15-labeled recombinant protein (NP_001041) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review