serum amyloid A2 (SAA2) (NM_030754) Human Recombinant Protein

CAT#: TP304977SE

Purified recombinant protein of Human serum amyloid A2 (SAA2), transcript variant 1, secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified SAA2 protein (Cat #TP304977SE). The protein was produced from mammalian cells transfected with SAA2 cDNA clone (Cat #RC204977).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204977 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGA
  WAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 15.2 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_110381
• Locus ID: 6289
• UniProt ID: P02735, P0DJI9
• Cytogenetics: 11p15.1
• Refseq Size: 594
• Refseq ORF: 366
• Synonyms: SAA; SAA1
• Summary: This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. [provided by RefSeq, Jul 2020]
• Protein Families: Druggable Genome