Frataxin (FXN) (NM_000144) Human Recombinant Protein
CAT#: TP304880
Recombinant protein of human frataxin (FXN), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204880 protein sequence
Red=Cloning site Green=Tags(s) MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKK QSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDL GTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000135 |
Locus ID | 2395 |
UniProt ID | Q16595, A0A0S2Z3G4 |
Cytogenetics | 9q21.11 |
Refseq Size | 7168 |
Refseq ORF | 630 |
Synonyms | CyaY; FA; FARR; FRDA; X25 |
Summary | This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400054 | FXN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431136 | FXN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400054 | Transient overexpression lysate of frataxin (FXN), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY431136 | Transient overexpression lysate of frataxin (FXN), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
PH304880 | FXN MS Standard C13 and N15-labeled recombinant protein (NP_000135) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review