Galectin 1 (LGALS1) (NM_002305) Human Recombinant Protein

CAT#: TP304674

Reviews ()
Write a review

Recombinant protein of human lectin, galactoside-binding, soluble, 1 (LGALS1)



  View other "LGALS1" proteins (4)

USD 823.00


Availability*
In Stock

Size
    • 20 ug


Product images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204674 protein sequence
Red=Cloning site Green=Tags(s)

MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG
TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.5 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002296
Locus ID 3956
UniProt ID P09382, A0A384MR27
Cytogenetics 22q13.1
Refseq Size 586
Refseq ORF 405
Synonyms GAL1; GBP
Summary The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome

Documents

Other Versions

Other products for "LGALS1"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 385.00


LGALS1 mouse monoclonal antibody,clone OTI7C3
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.