GCP2 (CXCL6) (NM_002993) Human Recombinant Protein

CAT#: TP304573SE

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) (CXCL6), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified CXCL6 protein (Cat #TP304573SE). The protein was produced from mammalian cells transfected with CXCL6 cDNA clone (Cat #RC204573).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204573 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFP
  AGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-Myc/DDK
• Predicted MW: 12.2 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002984
• Locus ID: 6372
• UniProt ID: P80162
• Cytogenetics: 4q13.3
• Refseq Size: 1677
• Refseq ORF: 342
• Synonyms: CKA-3; GCP-2; GCP2; SCYB6
• Summary: The protein encoded by this gene is a member CXC chemokine family. The encoded protein is a chemotactic for neutrophil granulocytes and has antibacterial action against gram-negative and gram-positive bacteria. This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q. [provided by RefSeq, Jun 2020]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction