SERBP1 (NM_001018068) Human Recombinant Protein

CAT#: TP304527M

Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2, 100 µg

Product Images

Coomassie blue staining of purified SERBP1 protein (Cat# TP304527). The protein was produced from HEK293T cells transfected with SERBP1 cDNA clone (Cat# RC204527) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204527 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
  RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
  PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKR
  GGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPK
  EMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLE
  INFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001018078
• Locus ID: 26135
• UniProt ID: Q8NC51
• Cytogenetics: 1p31.3
• Refseq Size: 6746
• Refseq ORF: 1206
• Synonyms: CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1
• Summary: May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation (PubMed:28695742).[UniProtKB/Swiss-Prot Function]