Rad6 (UBE2A) (NM_003336) Human Recombinant Protein

CAT#: TP304194

Recombinant protein of human ubiquitin-conjugating enzyme E2A (RAD6 homolog) (UBE2A), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified UBE2A protein (Cat# TP304194). The protein was produced from HEK293T cells transfected with UBE2A cDNA clone (Cat# RC204194) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204194 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTV
  RFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR
  VSAIVEQSWRDC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003327
• Locus ID: 7319
• UniProt ID: P49459
• Cytogenetics: Xq24
• Refseq Size: 1878
• Refseq ORF: 456
• Synonyms: HHR6A; MRXS30; MRXSN; RAD6A; UBC2
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair, and may play a role in transcriptional regulation. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis