Bone marrow stromal cell antigen 1 (BST1) (NM_004334) Human Recombinant Protein

CAT#: TP304151

Recombinant protein of human bone marrow stromal cell antigen 1 (BST1), 20 µg

Product Images

Coomassie blue staining of purified BST1 protein (Cat# TP304151). The protein was produced from HEK293T cells transfected with BST1 cDNA clone (Cat# RC204151) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204151 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAI
  WEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADF
  LSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYE
  IPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC
  ALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004325
• Locus ID: 683
• UniProt ID: Q10588
• Cytogenetics: 4p15.32
• Refseq Size: 1497
• Refseq ORF: 954
• Synonyms: CD157
• Summary: Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Calcium signaling pathway, Metabolic pathways, Nicotinate and nicotinamide metabolism