NRBF2 (NM_030759) Human Recombinant Protein

CAT#: TP304061L

Recombinant protein of human nuclear receptor binding factor 2 (NRBF2), 1 mg

Product Images

Coomassie blue staining of purified NRBF2 protein (Cat# TP304061). The protein was produced from HEK293T cells transfected with NRBF2 cDNA clone (Cat# RC204061) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204061 representing NM_030759
  Red=Cloning site Green=Tags(s)
  
  MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLL
  IQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDT
  LLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGP
  IEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDI
  LKGFMNN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_110386
• Locus ID: 29982
• UniProt ID: Q96F24
• Cytogenetics: 10q21.3
• Refseq Size: 1866
• Refseq ORF: 861
• Synonyms: COPR; COPR1; COPR2; NRBF-2
• Summary: May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome