S100 alpha 6 (S100A6) (NM_014624) Human Recombinant Protein
CAT#: TP303951
Recombinant protein of human S100 calcium binding protein A6 (S100A6), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203951 protein sequence
Red=Cloning site Green=Tags(s) MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNF QEYVTFLGALALIYNEALKG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055439 |
Locus ID | 6277 |
UniProt ID | P06703 |
Cytogenetics | 1q21.3 |
Refseq Size | 683 |
Refseq ORF | 270 |
Synonyms | 2A9; 5B10; CABP; CACY; PRA; S10A6 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415155 | S100A6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415155 | Transient overexpression lysate of S100 calcium binding protein A6 (S100A6) |
USD 436.00 |
|
PH303951 | S100A6 MS Standard C13 and N15-labeled recombinant protein (NP_055439) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review