GNGT2 (NM_031498) Human Recombinant Protein
CAT#: TP303892
Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203892 protein sequence
Red=Cloning site Green=Tags(s) MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_113686 |
Locus ID | 2793 |
UniProt ID | O14610 |
Cytogenetics | 17q21.32 |
Refseq Size | 1057 |
Refseq ORF | 207 |
Synonyms | G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8 |
Summary | Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410491 | GNGT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410491 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2) |
USD 436.00 |
|
PH303892 | GNGT2 MS Standard C13 and N15-labeled recombinant protein (NP_113686) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review