GNGT2 (NM_031498) Human Recombinant Protein

CAT#: TP303892

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2), 20 µg

Product Images

Coomassie blue staining of purified GNGT2 protein (Cat# TP303892). The protein was produced from HEK293T cells transfected with GNGT2 cDNA clone (Cat# RC203892) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203892 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_113686
• Locus ID: 2793
• UniProt ID: O14610
• Cytogenetics: 17q21.32
• Refseq Size: 1057
• Refseq ORF: 207
• Synonyms: G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8
• Summary: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway