RGS13 (NM_144766) Human Recombinant Protein

CAT#: TP303804

Recombinant protein of human regulator of G-protein signaling 13 (RGS13), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified RGS13 protein (Cat# TP303804). The protein was produced from HEK293T cells transfected with RGS13 cDNA clone (Cat# RC203804) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203804 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETY
  KKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRF
  LKSEMYQKLLKTMQSNNSF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_658912
• Locus ID: 6003
• UniProt ID: O14921
• Cytogenetics: 1q31.2
• Refseq Size: 1538
• Refseq ORF: 477
• Summary: The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome