ZFYVE21 (NM_024071) Human Recombinant Protein
CAT#: TP303337
Recombinant protein of human zinc finger, FYVE domain containing 21 (ZFYVE21), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203337 protein sequence
Red=Cloning site Green=Tags(s) MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG RRQAVAWLVAMHKAAKLLYESRDQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076976 |
Locus ID | 79038 |
UniProt ID | Q9BQ24 |
Cytogenetics | 14q32.33 |
Refseq Size | 1470 |
Refseq ORF | 702 |
Synonyms | HCVP7TP1; ZF21 |
Summary | Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411387 | ZFYVE21 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411387 | Transient overexpression lysate of zinc finger, FYVE domain containing 21 (ZFYVE21) |
USD 436.00 |
|
PH303337 | ZFYVE21 MS Standard C13 and N15-labeled recombinant protein (NP_076976) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review