ATP6J (ATP6V1G1) (NM_004888) Human Recombinant Protein

CAT#: TP303317

Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 (ATP6V1G1), 20 µg

Product Images

Coomassie blue staining of purified ATP6V1G1 protein (Cat# TP303317). The protein was produced from HEK293T cells transfected with ATP6V1G1 cDNA clone (Cat# RC203317) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203317 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCS
  TEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004879
• Locus ID: 9550
• UniProt ID: O75348, A0A024R883
• Cytogenetics: 9q32
• Refseq Size: 1611
• Refseq ORF: 354
• Synonyms: ATP6G; ATP6G1; ATP6GL; ATP6J; Vma10
• Summary: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of three V1 domain G subunit proteins. Pseudogenes of this gene have been characterized. [provided by RefSeq, Jul 2008]
• Protein Pathways: Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection