G gamma12 (GNG12) (NM_018841) Human Recombinant Protein

CAT#: TP303268

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 12 (GNG12), 20 µg

Product Images

Coomassie blue staining of purified GNG12 protein (Cat# TP303268). The protein was produced from HEK293T cells transfected with GNG12 cDNA clone (Cat# RC203268) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203268 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI
  IL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061329
• Locus ID: 55970
• UniProt ID: Q9UBI6
• Cytogenetics: 1p31.3
• Refseq Size: 4427
• Refseq ORF: 216
• Summary: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway, MAPK signaling pathway, Regulation of actin cytoskeleton