HES6 (NM_018645) Human Recombinant Protein

CAT#: TP303205L

Recombinant protein of human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1, 1 mg

Product Images

Coomassie blue staining of purified HES6 protein (Cat# TP303205). The protein was produced from HEK293T cells transfected with HES6 cDNA clone (Cat# RC203205) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203205 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAKLENAEVLELT
  VRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSS
  FQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGS
  LTTAQIARSVWRPW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061115
• Locus ID: 55502
• UniProt ID: Q96HZ4
• Cytogenetics: 2q37.3
• Refseq Size: 1470
• Refseq ORF: 672
• Synonyms: bHLHb41; bHLHc23; C-HAIRY1; HES-6
• Summary: This gene encodes a member of a subfamily of basic helix-loop-helix transcription repressors that have homology to the Drosophila enhancer of split genes. Members of this gene family regulate cell differentiation in numerous cell types. The protein encoded by this gene functions as a cofactor, interacting with other transcription factors through a tetrapeptide domain in its C-terminus. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Dec 2008]
• Protein Families: Druggable Genome, Transcription Factors