Myosin light chain 3 (MYL3) (NM_000258) Human Recombinant Protein
Recombinant protein of human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203122 protein sequence
Red=Cloning site Green=Tags(s) MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000249 |
Locus ID | 4634 |
UniProt ID | P08590, A0A024R2Q5 |
Cytogenetics | 3p21.31 |
Refseq Size | 942 |
Refseq ORF | 585 |
Synonyms | CMH8; MLC-lV/sb; MLC1SB; MLC1V; VLC1; VLCl |
Summary | MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400098 | MYL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400098 | Transient overexpression lysate of myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3) |
USD 396.00 |
|
PH303122 | MYL3 MS Standard C13 and N15-labeled recombinant protein (NP_000249) |
USD 2,712.00 |
USD 385.00
USD 380.00