Germany
Japan
United Kingdom
China
C16orf13 (METTL26) (NM_001040161) Human Recombinant Protein
CAT#: TP303002
Recombinant protein of human chromosome 16 open reading frame 13 (C16orf13), transcript variant 3, 20 µg
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203002 protein sequence
Red=Cloning site Green=Tags(s) MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEW GLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 11.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035251 |
| Locus ID | 84326 |
| UniProt ID | Q96S19 |
| Cytogenetics | 16p13.3 |
| Refseq Size | 570 |
| Refseq ORF | 321 |
| Synonyms | C16orf13; JFP2 |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410160 | C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LC421703 | C16orf13 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LY410160 | Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 1 |
USD 436.00 |
|
| LY421703 | Transient overexpression lysate of chromosome 16 open reading frame 13 (C16orf13), transcript variant 3 |
USD 436.00 |
|
| PH303002 | C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_001035251) |
USD 3,255.00 |
|
| PH318337 | C16orf13 MS Standard C13 and N15-labeled recombinant protein (NP_115742) |
USD 3,255.00 |
|
| TP318337 | Recombinant protein of human chromosome 16 open reading frame 13 (C16orf13), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review
