Cpn10 (HSPE1) (NM_002157) Human Recombinant Protein

SKU TP302891

Recombinant protein of human heat shock 10kDa protein 1 (chaperonin 10) (HSPE1), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202891 protein sequence; Red=Cloning site Green=Tags(s); ; MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDK; VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002148
• Locus ID: 3336
• UniProt ID: P61604
• Cytogenetics: 2q33.1
• RefSeq Size: 965
• RefSeq ORF: 306
• Synonyms: CPN10; EPF; GROES; HSP10
• Summary: This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.[provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Stem cell - Pluripotency