AKR1A1 (NM_153326) Human Recombinant Protein

SKU TP302813L

Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2, 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202813 protein sequence; Red=Cloning site Green=Tags(s); ; MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV; PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY; KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY; SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT; FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_697021
• Locus ID: 10327
• UniProt ID: P14550
• Cytogenetics: 1p34.1
• RefSeq Size: 1469
• RefSeq ORF: 975
• Synonyms: ALDR1; ALR; ARM; DD3; HEL-S-6
• Summary: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. [provided by RefSeq, Jan 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways