Apolipoprotein CII (APOC2) (NM_000483) Human Recombinant Protein

CAT#: TP302771

Recombinant protein of human apolipoprotein C-II (APOC2), 20 µg

Product Images

Coomassie blue staining of purified APOC2 protein (Cat# TP302771). The protein was produced from HEK293T cells transfected with APOC2 cDNA clone (Cat# RC202771) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202771 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEK
  LRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000474
• Locus ID: 344
• UniProt ID: P02655, A0A024R0T9
• Cytogenetics: 19q13.32
• Refseq Size: 738
• Refseq ORF: 303
• Synonyms: APO-CII; APOC-II
• Summary: This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is secreted in plasma where it is a component of very low density lipoprotein. This protein activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells. Mutations in this gene cause hyperlipoproteinemia type IB, characterized by hypertriglyceridemia, xanthomas, and increased risk of pancreatitis and early atherosclerosis. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring upstream apolipoprotein C-IV (APOC4) gene. [provided by RefSeq, Mar 2011]
• Protein Families: Druggable Genome, Secreted Protein