FABP3 (NM_004102) Human Recombinant Protein

CAT#: TP302737M

Recombinant protein of human fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3), 100 µg

Product Images

Coomassie blue staining of purified FABP3 protein (Cat# TP302737). The protein was produced from HEK293T cells transfected with FABP3 cDNA clone (Cat# RC202737) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202737 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE
  FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004093
• Locus ID: 2170
• UniProt ID: P05413, A0A384MDY5
• Cytogenetics: 1p35.2
• Refseq Size: 1097
• Refseq ORF: 399
• Synonyms: FABP11; H-FABP; M-FABP; MDGI; O-FABP
• Summary: The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
• Protein Pathways: PPAR signaling pathway