CXCL5 (NM_002994) Human Recombinant Protein

CAT#: TP302707SE

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified CXCL5 protein (Cat #TP302707SE). The protein was produced from mammalian cells transfected with CXCL5 cDNA clone (Cat #RC202707).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202707 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA
  IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.0 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002985
• Locus ID: 6374
• UniProt ID: P42830, Q6I9S7
• Cytogenetics: 4q13.3
• Refseq Size: 2505
• Refseq ORF: 342
• Synonyms: ENA-78; SCYB5
• Summary: This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction