OriGene Logo

C14ORF140 (ZC2HC1C) (NM_001042430) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302554
Recombinant protein of human family with sequence similarity 164, member C (FAM164C), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335958 Rabbit Polyclonal Anti-ZC2HC1C Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "C14ORF140 or NM_001042430"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202554 protein sequence
Red=Cloning site Green=Tags(s)

MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYT
HPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFP
LKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEW
VQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035895
Locus ID 79696
UniProt ID Q53FD0
Cytogenetics 14q24.3
RefSeq Size 3471
RefSeq ORF 825
Synonyms C14orf140; FAM164C
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "C14ORF140" proteins (5)
SKU Description Size Price
PH302554 FAM164C MS Standard C13 and N15-labeled recombinant protein (NP_001035895) 10 ug
$3,360.00
LC411092 ZC2HC1C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420900 ZC2HC1C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411092 Transient overexpression lysate of family with sequence similarity 164, member C (FAM164C), transcript variant 1 100 ug
$665.00
LY420900 Transient overexpression lysate of family with sequence similarity 164, member C (FAM164C), transcript variant 2 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.