ZSCAN16 (NM_025231) Human Recombinant Protein

CAT#: TP302518L

Recombinant protein of human zinc finger and SCAN domain containing 16 (ZSCAN16), 1 mg

Product Images

Coomassie blue staining of purified ZSCAN16 protein (Cat# TP302518). The protein was produced from HEK293T cells transfected with ZSCAN16 cDNA clone (Cat# RC202518) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202518 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALTQLWELCRQWL
  RPECHTKEQILDLLVLEQFLSILPKDLQAWVRAHHPETGEEAVTVLEDLERELDEPGKQVPGNSERRDIL
  MDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTRTKNEELFQKEDMPKDKEFLGEINDRLNKDT
  PQHPKSKDIIENEGRSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLI
  GHHRVHTGVKPYKCKECGKDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079507
• Locus ID: 80345
• UniProt ID: Q9H4T2
• Cytogenetics: 6p22.1
• Refseq Size: 1290
• Refseq ORF: 1044
• Synonyms: dJ265C24.3; ZNF392; ZNF435
• Summary: May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors