POLR1D (NM_152705) Human Recombinant Protein
CAT#: TP302300
Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202300 protein sequence
Red=Cloning site Green=Tags(s) MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDK EPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689918 |
Locus ID | 51082 |
UniProt ID | P0DPB5 |
Cytogenetics | 13q12.2 |
Refseq Size | 2043 |
Refseq ORF | 366 |
Synonyms | AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2 |
Summary | The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011] |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407348 | POLR1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC414277 | POLR1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407348 | Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2 |
USD 436.00 |
|
LY414277 | Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1 |
USD 436.00 |
|
PH301466 | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_057056) |
USD 3,255.00 |
|
PH302300 | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_689918) |
USD 3,255.00 |
|
TP301466 | Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review