NUR77 (NR4A1) (NM_002135) Human Recombinant Protein

CAT#: TP302202

Purified recombinant protein of Homo sapiens nuclear receptor subfamily 4, group A, member 1 (NR4A1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified NR4A1 protein (Cat# TP302202). The protein was produced from HEK293T cells transfected with NR4A1 cDNA clone (Cat# RC202202) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202202 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQ
  LPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPS
  PSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLF
  PSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYG
  VRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLP
  SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW
  AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFS
  RSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLP
  ELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 64.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002126
• Locus ID: 3164
• UniProt ID: P22736, A0A024R126
• Cytogenetics: 12q13.13
• Refseq Size: 2692
• Refseq ORF: 1794
• Synonyms: GFRP1; HMR; N10; NAK-1; NGFIB; NP10; NUR77; TR3
• Summary: This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: MAPK signaling pathway