Noxa (PMAIP1) (NM_021127) Human Recombinant Protein

CAT#: TP302071M

Reviews ()
Write a review

Recombinant protein of human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1)

Size: 20 ug 100 ug 1 mg



USD 2,950.00

8 Weeks*

Size
    • 100 ug

Product images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00


Rabbit Polyclonal Noxa Antibody
    • 100 ug

USD 528.00

Other products for "PMAIP1"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC202071 representing NM_021127
Red=Cloning site Green=Tags(s)

MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 5.8 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_066950
Locus ID 5366
UniProt ID Q13794, A0A0S2Z490
Cytogenetics 18q21.32
Refseq Size 1885
Refseq ORF 162
Synonyms APR; NOXA
Summary This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state. [provided by RefSeq, Aug 2020]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways p53 signaling pathway
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.