Nucleobindin 1 (NUCB1) (NM_006184) Human Recombinant Protein

CAT#: TP301786SE

Purified recombinant protein of Human nucleobindin 1 (NUCB1), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified NUCB1 protein (Cat #TP301786SE). The protein was produced from mammalian cells transfected with NUCB1 cDNA clone (Cat #RC201786).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201786 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVIDVLETDGHFRE
  KLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMDAEQDPNVQVDHLNLLKQFEH
  LDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEEQQ
  RRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPK
  NEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRF
  EEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL
  KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 54.7 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006175
• Locus ID: 4924
• UniProt ID: Q02818, A8K7Q1
• Cytogenetics: 19q13.33
• Refseq Size: 2585
• Refseq ORF: 1383
• Synonyms: CALNUC; NUC
• Summary: This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. [provided by RefSeq, Jun 2010]