CREG1 (NM_003851) Human Recombinant Protein

CAT#: TP301654SE

Purified recombinant protein of Human cellular repressor of E1A-stimulated genes 1 (CREG1), secretory expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified CREG1 protein (Cat #TP301654SE). The protein was produced from mammalian cells transfected with CREG1 cDNA clone (Cat #RC201654).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201654 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVARFVTHVSDWGA
  LATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGF
  DPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVT
  PEEYYNVTVQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.7 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003842
• Locus ID: 8804
• UniProt ID: O75629
• Cytogenetics: 1q24.2
• Refseq Size: 2048
• Refseq ORF: 660
• Synonyms: CREG
• Summary: The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein, Transcription Factors, Transmembrane