ornithine aminotransferase (OAT) (NM_000274) Human Recombinant Protein

CAT#: TP301610

Purified recombinant protein of Homo sapiens ornithine aminotransferase (gyrate atrophy) (OAT), nuclear gene encoding mitochondrial protein, 20 µg

Product Images

Coomassie blue staining of purified OAT protein (Cat# TP301610). The protein was produced from HEK293T cells transfected with OAT cDNA clone (Cat# RC201610) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201610 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYL
  WDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMN
  TGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYN
  DLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDY
  ENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENAD
  KLGIILRNELMKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
  KEDELRESIEIINKTILSF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 48.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000265
• Locus ID: 4942
• UniProt ID: P04181, A0A140VJQ4
• Cytogenetics: 10q26.13
• Refseq Size: 2102
• Refseq ORF: 1317
• Synonyms: GACR; HOGA; OATASE; OKT
• Summary: This gene encodes the mitochondrial enzyme ornithine aminotransferase, which is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Alternatively spliced transcript variants encoding different isoforms have been described. Related pseudogenes have been defined on the X chromosome. [provided by RefSeq, Jan 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways