RING finger protein unkempt like (UNKL) (NM_023076) Human Recombinant Protein

CAT#: TP301609

Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified UNKL protein (Cat# TP301609). The protein was produced from HEK293T cells transfected with UNKL cDNA clone (Cat# [RC201609]) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201609 representing NM_023076
  Red=Cloning site Green=Tags(s)
  
  MTCCSQVPPRRRPSLALSPRLDCNGLNGVPGSIWDFVSGSFSPSPSPILSAGPPSSSSASPNGAELARVR
  RQLDEAKRKIRQWEESWQQVKQVCDAWQREAQEAKERARVADSDRQLALQKKEEVEAQVKQLQEELEGLG
  VASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCE
  PCAATAPECPYCKGQPLQW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075564
• Locus ID: 64718
• UniProt ID: Q9H9P5
• Cytogenetics: 16p13.3
• Refseq Size: 4135
• Refseq ORF: 699
• Synonyms: C16orf28; ZC3H5L; ZC3HDC5L
• Summary: This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2013]
• Protein Families: Druggable Genome